DPCfam | MC429928
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 99 ± 12 aa |
| Residues in low-complexity regions (%) | 1.26 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.29 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01140 |
| Sequences matching dominant architecture (%) | 78.95 |
| Average overlap percent | 85.87 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007AD8C15 | 1-103 | 103 | MGASESKEIPKVSPLGSVLAHWKELVGYGGTETKKELVKFCTRWWPLYRLEEGVKWPSTGTFDYETLLQLMLFLRREQKWQEVTY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q68D85-F1 | 291-383 | 92.31 | 87.54 | View in AlphaFoldDB ↗ |