DPCfam | MC429889
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 311 ± 31 aa |
| Residues in low-complexity regions (%) | 1.23 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.27 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00211 |
| Sequences matching dominant architecture (%) | 91.18 |
| Average overlap percent | 12.4 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0002DACAA1 | 754-1056 | 303 | VEMLGIFLANAPDQEVSRIKPLAIARRFGIDEMAMVETCLRSVLEGLLQLQWDVICPLCRVPSGHRDTLKQILEHENCPTCDASF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q38DD1-F1 | 86-318 | 65.12 | 83.64 | View in AlphaFoldDB ↗ |