DPCfam | MC429598
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 197 ± 28 aa |
| Residues in low-complexity regions (%) | 5.54 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.09 |
| Average transmembrane regions | 0.48 |
| Dominant Pfam architecture(s) | PF09402 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 56.42 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A017SDR7 | 349-526 | 178 | WVVILSLLSGFAGWWRKEKVEIGFCGIGKPTWSLAETKVPEWANVLEPQCEPCPPHAFCYPNFEARCEHDFILTSHPLSLGGLIP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W7Y3-F1 | 32-237 | 98.49 | 86.49 | View in AlphaFoldDB ↗ |