DPCfam | MC428883
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 484 ± 56 aa |
| Residues in low-complexity regions (%) | 7.62 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.85 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A171KNX3 | 2519-2954 | 436 | AGGSLRLDTAVLLPSGKLTLAAAGDVLLDEGAQLDLAGRRLVFYDQEKYSWGGDVILNSREGGIRQAVGSTILLDAQYNRAGRLN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7K1W5-F1 | 125-279 | 30.89 | 97.51 | View in AlphaFoldDB ↗ |