DPCfam | MC428724
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 136 ± 17 aa |
| Residues in low-complexity regions (%) | 2.1 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.01 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00065B841C | 521-659 | 139 | TCPHGYLALLLGENVRVCVSDQYSEAVENQLPFAGFFSCSTGNPLALGSVNSSLTAHMYSEGPESWPRRCPKGYSQFTTEIMPGD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A5K4F429-F1 | 533-737 | 95.65 | 63.75 | View in AlphaFoldDB ↗ |