DPCfam | MC427883
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 291 ± 30 aa |
| Residues in low-complexity regions (%) | 2.93 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.47 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18156- PF18154 |
| Sequences matching dominant architecture (%) | 49.57 |
| Average overlap percent | 86.49 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00040BA4FC | 87-339 | 253 | IVGGEDVPVYDSFKRTVRSEWRHAVAELPEDRGTELYRHVYEQCKDYGGEKDFIRFREQLGSGDFSCLLKRRNVEGLVEQLPLPV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P46494-F1 | 12-47 | 11.35 | 88.46 | View in AlphaFoldDB ↗ |