DPCfam | MC42740
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 212 ± 24 aa |
| Residues in low-complexity regions (%) | 16.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.14 |
| Average transmembrane regions | 0.39 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A133LLZ0 | 292-516 | 225 | EQAEAKQYDWNETSRIDIAKNIGKNAGTAALLSVGFQGARILGRRIWKGITGQENNSAEEDLQEFVQSALKSAATSGLSVAVTGA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O31557-F1 | 264-360 | 41.40 | 45.90 | View in AlphaFoldDB ↗ |