DPCfam | MC427354
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 97 ± 10 aa |
| Residues in low-complexity regions (%) | 5.41 |
| Residues in coiled-coil regions (%) | 28.91 |
| Predicted disordered residues (%) | 35.67 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000742A4F6 | 791-884 | 94 | PPAPSFKLVCSNLDELRELISKTEDELDELESMKKRPGRWYYKKEAVKELHSTLIRLLNELLPWEPKLVKAYQRNRLRLKKEFDD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-H3BKP8-F1 | 691-786 | 98.00 | 84.45 | View in AlphaFoldDB ↗ |