DPCfam | MC427087
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 254 ± 43 aa |
| Residues in low-complexity regions (%) | 0.9 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.55 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01835 |
| Sequences matching dominant architecture (%) | 2.53 |
| Average overlap percent | 37.91 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F7BGD9 | 45-279 | 235 | DLSQGELWTLALNVPQSSYRIGEAVSFQIGIVDQAGETVCDGLLSINVRAPDGNTTILSSEEGTVRRIERCGNRAISDTADYTAS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q723X5-F1 | 821-881 | 21.40 | 85.42 | View in AlphaFoldDB ↗ |