DPCfam | MC426862
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 76 ± 13 aa |
| Residues in low-complexity regions (%) | 4.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 33.72 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1U1BA30 | 174-235 | 61 | SSTKMMQGLFCLACSNRSRTREAPTPTNISTKSEPEMVKNGTPASPATARANSVLPVPGGP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D8PNC2-F1 | 63-144 | 98.80 | 60.88 | View in AlphaFoldDB ↗ |