DPCfam | MC426473
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 72 ± 12 aa |
| Residues in low-complexity regions (%) | 4.33 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.63 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11356 |
| Sequences matching dominant architecture (%) | 0.52 |
| Average overlap percent | 60.32 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q8XTG7 | 102-168 | 67 | PPLPFVVIGKKWEDGQWQVFLGRNEETFVVKAGDTFDGRYRVDSIVPPSMTLIYLPLKARQTLTIGN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8ZLK1-F1 | 37-87 | 66.67 | 94.59 | View in AlphaFoldDB ↗ |