DPCfam | MC426264
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 59 ± 5 aa |
| Residues in low-complexity regions (%) | 3.48 |
| Residues in coiled-coil regions (%) | 2.51 |
| Predicted disordered residues (%) | 9.79 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10540 |
| Sequences matching dominant architecture (%) | 92.54 |
| Average overlap percent | 37.35 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H9XVP2 | 2940-3002 | 63 | PKQCAVLDVALDTIKQYFHAGGNGLKKTFLEKSPELQSLRYALSLYTQMTDTLIKTFISSQVH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3P7DVI9-F1 | 47-111 | 85.53 | 86.37 | View in AlphaFoldDB ↗ |