DPCfam | MC42618
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 166 ± 13 aa |
| Residues in low-complexity regions (%) | 8.37 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 33.53 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11290 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 96.18 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E3J0N1 | 5-172 | 167 | VFDPPERFVVGTVGQPGERAFYLQAAQSGQLVTIGLEKAEVTALAEGLSALLGQVGQQQGVPVPAAADVEVDLAPLQAPFEEDFH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O06241-F1 | 8-180 | 99.40 | 88.90 | View in AlphaFoldDB ↗ |