DPCfam | MC425915
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 202 ± 19 aa |
| Residues in low-complexity regions (%) | 2.89 |
| Residues in coiled-coil regions (%) | 2.25 |
| Predicted disordered residues (%) | 20.11 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF08900 |
| Sequences matching dominant architecture (%) | 98.9 |
| Average overlap percent | 96.6 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V4N3J7 | 7-178 | 172 | TKNSAGTLTGGFHIELHTHYAAGIWNGRSAAGTKKKLIGVPPFLTLISRIHNDALTGNLAAGFVLSALEEKLISAGNAFQQWQYE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3H318-F1 | 13-219 | 100.00 | 95.38 | View in AlphaFoldDB ↗ |