DPCfam | MC425528
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 106 ± 16 aa |
| Residues in low-complexity regions (%) | 7.57 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 54.26 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13639 |
| Sequences matching dominant architecture (%) | 21.95 |
| Average overlap percent | 2.96 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K3XYW6 | 103-216 | 114 | EEQIASDFEYAKRLQEMEDQDDDISCVPSPSDSDDDDDHDHNDEEADRQDGNDDDPDNMTYEQRQALVESVGTEDRGLSDELISY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B7EJC9-F1 | 91-201 | 99.11 | 70.73 | View in AlphaFoldDB ↗ |