DPCfam | MC425314
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 111 ± 20 aa |
| Residues in low-complexity regions (%) | 18.42 |
| Residues in coiled-coil regions (%) | 0.26 |
| Predicted disordered residues (%) | 51.25 |
| Average transmembrane regions | 0.22 |
| Dominant Pfam architecture(s) | PF00122- PF00122 |
| Sequences matching dominant architecture (%) | 74.32 |
| Average overlap percent | 42.84 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0R3R8I4 | 199-284 | 86 | MEGSGKMVITAVGVNSQTGIIMTLLGAAKGTTSKKSPNTVAPEEQINGTTSEIERKHSVDSAEYDCKLPKSVLQGKLSALAIQIG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F6PDY7-F1 | 262-377 | 99.15 | 51.06 | View in AlphaFoldDB ↗ |