DPCfam | MC425290
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 336 ± 43 aa |
| Residues in low-complexity regions (%) | 5.94 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.67 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00036FD97D | 40-392 | 353 | DPATRNALTTYDSASGVLTFAQSTPALSSLKPGDVLVSEPSSAAPDGYLRKVTAIRPEGGQILLDTTQANLTDAITDGDLNADFQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CQX4-F1 | 23-102 | 24.93 | 74.88 | View in AlphaFoldDB ↗ |