DPCfam | MC425249
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 328 ± 56 aa |
| Residues in low-complexity regions (%) | 2.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.76 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00764 |
| Sequences matching dominant architecture (%) | 87.96 |
| Average overlap percent | 95.44 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A323B24 | 8-235 | 227 | DKVVLAYSGGLDTTVIIPWLKEHYEYDVIAVCIDLGQGDDWKLIKQRALDTGAAACYVVDAREEYVREYVFPALKANAVYEDRYL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P09034-F1 | 10-374 | 100.00 | 96.92 | View in AlphaFoldDB ↗ |