DPCfam | MC4250
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 881 |
|---|---|
| Mean domain length (aa) | 201 ± 14 aa |
| Residues in low-complexity regions (%) | 1.42 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.67 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF04333 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 94.47 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0A1H3Z6 | 18-224 | 207 | ATVPQDAGKNPADPYERFNRQVYAFNDVFDRYVGKPVAKGYTDVTPKPVRTCVGNIFSNFGEIATFVDTSLEGRPHDAAVSFGRL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I043-F1 | 31-223 | 97.03 | 95.82 | View in AlphaFoldDB ↗ |