DPCfam | MC424958
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 147 ± 16 aa |
| Residues in low-complexity regions (%) | 1.66 |
| Residues in coiled-coil regions (%) | 0.31 |
| Predicted disordered residues (%) | 10.77 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF10266 |
| Sequences matching dominant architecture (%) | 97.18 |
| Average overlap percent | 19.9 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S9X2F6 | 729-889 | 161 | ELMPKLKELGAAMDGFHRSFEYIQDYVNIYGLKIWQEEVSRIINYNVEQECNNFLRTKIQDWQSMYQSTHIPIPKFTPVDESVTF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6DIP9-F1 | 741-893 | 99.35 | 91.21 | View in AlphaFoldDB ↗ |