DPCfam | MC424898
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1311 |
|---|---|
| Mean domain length (aa) | 100 ± 7 aa |
| Residues in low-complexity regions (%) | 1.79 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.03 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05521 |
| Sequences matching dominant architecture (%) | 97.17 |
| Average overlap percent | 90.71 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A3PGD7 | 1-101 | 101 | MQAGKLARVIEIEGATFATDDFGTPIPTWSRKAILRAEIVTAEASEFIRGWGVSEETAIVFRTRFLDGITMSDRVSFDGQHFNIK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2FWT7-F1 | 5-106 | 97.47 | 92.38 | View in AlphaFoldDB ↗ |