DPCfam | MC424838
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 69 ± 8 aa |
| Residues in low-complexity regions (%) | 0.6 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.99 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1K1KKS8 | 214-289 | 76 | MPLSAFDRLFPSQDLIQSDKPGNLIAAPLQGQRRKENKTVFVDAHFRPYQQQWKILENIVRLNEKQTDQLISKLQT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8CZ36-F1 | 231-298 | 95.77 | 91.74 | View in AlphaFoldDB ↗ |