DPCfam | MC424676
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 67 ± 7 aa |
| Residues in low-complexity regions (%) | 3.19 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 46.99 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01507 |
| Sequences matching dominant architecture (%) | 83.08 |
| Average overlap percent | 8.77 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00099D0EAA | 240-303 | 64 | PGEDEPVEVRLIRYRTVGDMSCTGAVDSDAATIEAVIAEIAASRLTERGATRADDKLSEAAMED... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A1UK27-F1 | 243-309 | 100.00 | 83.08 | View in AlphaFoldDB ↗ |