DPCfam | MC424415
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1471 |
|---|---|
| Mean domain length (aa) | 193 ± 34 aa |
| Residues in low-complexity regions (%) | 2.97 |
| Residues in coiled-coil regions (%) | 8.9 |
| Predicted disordered residues (%) | 1.39 |
| Average transmembrane regions | 5.09 |
| Dominant Pfam architecture(s) | PF01151 |
| Sequences matching dominant architecture (%) | 91.87 |
| Average overlap percent | 86.24 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q17Q14 | 42-266 | 225 | LYLKFVNNWGQKMMANRQPFGLKTAMNVYNAVQIVLNLYIGITGFANSYFSDDYDWVCEPISQKVTPTRQRLIFVTYLYYLSKIL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VHX7-F1 | 50-261 | 99.50 | 94.63 | View in AlphaFoldDB ↗ |