DPCfam | MC424345
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 209 ± 22 aa |
| Residues in low-complexity regions (%) | 5.53 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.32 |
| Average transmembrane regions | 1.11 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A084G1M8 | 166-360 | 195 | ARPRKDSGIKWDSVRRGLTKISIARDEKSQPLSSRNPSFERTEYIGGLRHLLTSLPPDLTPAEISALRSSLPRPLHPSSPHMHPS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PTA3-F1 | 117-345 | 97.54 | 72.82 | View in AlphaFoldDB ↗ |