DPCfam | MC424293
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 6991 |
|---|---|
| Mean domain length (aa) | 469 ± 65 aa |
| Residues in low-complexity regions (%) | 2.17 |
| Residues in coiled-coil regions (%) | 10.93 |
| Predicted disordered residues (%) | 21.01 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14322- PF07980 |
| Sequences matching dominant architecture (%) | 87.71 |
| Average overlap percent | 91.19 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I9HB54 | 18-596 | 579 | TTFSACQDFLSEKPYSFVGPEEVGNDDAAVSQWVTGVYSKWADDMFRWGNFPRVLDMDCDYASGPDWAFSNAGAGNYQGDDVTNT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-T2KN63-F1 | 33-488 | 95.74 | 96.33 | View in AlphaFoldDB ↗ |