DPCfam | MC424216
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 108 ± 18 aa |
| Residues in low-complexity regions (%) | 12.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 56.19 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G9KQP5 | 15-82 | 67 | QGDYTDLQAPSYYGPYPGCPSSLYQCPYFHPSRRPYASPLLSGLSVPPAHSPPGNWDQPVYTTLTRP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q04886-F1 | 342-464 | 100.00 | 44.07 | View in AlphaFoldDB ↗ |