DPCfam | MC42392
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 70 ± 10 aa |
| Residues in low-complexity regions (%) | 1.84 |
| Residues in coiled-coil regions (%) | 18.84 |
| Predicted disordered residues (%) | 27.91 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G7YX39 | 57-115 | 59 | ALTDANTKNAAIWTKVDKELSSLNEYLALSTPGPLAAKKGIQLSDAAIKTATASLVDRR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4DLT5-F1 | 59-82 | 31.17 | 54.07 | View in AlphaFoldDB ↗ |