DPCfam | MC423847
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 81 ± 9 aa |
| Residues in low-complexity regions (%) | 2.19 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.01 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00830 |
| Sequences matching dominant architecture (%) | 25.0 |
| Average overlap percent | 13.07 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V9XI24 | 21-105 | 85 | DRFPKCYQQFLEDLKRPRTPVNYVPLKERFYWDAEQGKVLPVIDAPIETLFPPESQKGLWGGEGVIKGYIQRKKSKVERPFAIKT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9D1B9-F1 | 18-96 | 97.56 | 95.06 | View in AlphaFoldDB ↗ |