DPCfam | MC423781
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 75 ± 8 aa |
| Residues in low-complexity regions (%) | 0.39 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.24 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1U9NMV8 | 264-337 | 74 | VTAADISPSGNQIIIRNYNQAMLWHRPEDENIADALAKSGQLVPLEAEKQGEAICFAADGKGYFTVSEKKRQPI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X8F7M0-F1 | 191-261 | 97.26 | 95.05 | View in AlphaFoldDB ↗ |