DPCfam | MC423717
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 160 ± 22 aa |
| Residues in low-complexity regions (%) | 7.45 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 59.08 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13920 |
| Sequences matching dominant architecture (%) | 1.64 |
| Average overlap percent | 1.08 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B0DKQ3 | 30-165 | 136 | KQWPKNSRRREPNGHSGSKDPTRSKPPNGHHQQRIDKKPPRGRGNHQTSPQGTGKGGDLEASGSSSGLGLEEDPVAQYELNSVFL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q08E13-F1 | 47-216 | 98.16 | 55.54 | View in AlphaFoldDB ↗ |