DPCfam | MC423612
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 108 ± 14 aa |
| Residues in low-complexity regions (%) | 9.96 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.13 |
| Average transmembrane regions | 2.32 |
| Dominant Pfam architecture(s) | PF01889 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 45.26 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A166AW41 | 205-306 | 102 | KIYRDKYNLSIISAHLLDATTTFIAVDFYGYIEQHVLPNLIYSEFSTATSIYPLKIIVISLAIYSIDKYIDDKTIKGLLKLAIFI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q57882-F1 | 202-299 | 97.12 | 96.77 | View in AlphaFoldDB ↗ |