DPCfam | MC423370
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 531 ± 76 aa |
| Residues in low-complexity regions (%) | 8.57 |
| Residues in coiled-coil regions (%) | 0.8 |
| Predicted disordered residues (%) | 2.6 |
| Average transmembrane regions | 11.71 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1C5PTB7 | 21-621 | 601 | KEKLTDCIPAAVSLLILFLYGLSFGNLLWLTDILAPLFLLGSGILVFKMDRKKRKELVSFAGRELRAPAFLTALLLFMVVTVCVS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P37788-F1 | 1-198 | 36.02 | 89.30 | View in AlphaFoldDB ↗ |