DPCfam | MC42333
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 161 ± 23 aa |
| Residues in low-complexity regions (%) | 2.11 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.32 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04526 |
| Sequences matching dominant architecture (%) | 96.73 |
| Average overlap percent | 62.63 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W5FRD2 | 39-201 | 163 | EEFPAGRSYATCADLPALGASLHWTYDAAASSLSLAFAAKPPGASGAGWVAWGVNPTGDGMKGAQTLLAFKSKGAYVVNTYNLTG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1KYI2-F1 | 30-194 | 98.80 | 91.81 | View in AlphaFoldDB ↗ |