DPCfam | MC423093
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 79 ± 11 aa |
| Residues in low-complexity regions (%) | 16.78 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 56.04 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00536 |
| Sequences matching dominant architecture (%) | 5.56 |
| Average overlap percent | 29.4 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S9WVR7 | 169-248 | 80 | IRSLPKALIDMHLSKNVSKSDSDLIAYPSSEKTSRVNWSESSNAEHSSKGNSERTPSFTSEWEEIDKIMNSIDVGINSGL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D4AC12-F1 | 603-680 | 98.75 | 40.50 | View in AlphaFoldDB ↗ |