DPCfam | MC422810
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 271 ± 37 aa |
| Residues in low-complexity regions (%) | 1.64 |
| Residues in coiled-coil regions (%) | 0.32 |
| Predicted disordered residues (%) | 26.65 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06067 |
| Sequences matching dominant architecture (%) | 99.35 |
| Average overlap percent | 78.88 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E6QMX5 | 24-310 | 287 | WHGYGQKLESGASIEDWANAASFNWKILSTPAMFSPEGSDLSPVPGSNVLYRSDAHTPLSIVSDRYQVVQPMEVLEFFRDLTNQM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P18005-F1 | 98-224 | 44.85 | 90.12 | View in AlphaFoldDB ↗ |