DPCfam | MC422599
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 321 |
|---|---|
| Mean domain length (aa) | 231 ± 27 aa |
| Residues in low-complexity regions (%) | 0.79 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.89 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07677- PF01759 |
| Sequences matching dominant architecture (%) | 85.43 |
| Average overlap percent | 95.48 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0008148960 | 134-371 | 238 | MAIADITLLSGFEPNTEDLDKLKDLADKYISHYEVSQGRVLLYFNEIVEGDVCVMFEAVQKVPIGLVQPAPATFYDYYEPDRRCS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P23667-F1 | 59-298 | 100.00 | 86.34 | View in AlphaFoldDB ↗ |