DPCfam | MC422439
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 300 ± 32 aa |
| Residues in low-complexity regions (%) | 1.93 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.31 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00012 |
| Sequences matching dominant architecture (%) | 0.83 |
| Average overlap percent | 33.22 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R7YPC5 | 38-337 | 300 | YGTVAISYHNGTTVNVAKINASSPYHETMARLSLHSSQHLHPPYINMDEEWRDYPRQLLRRWRKMRGLPASNDVGALSGMITDLR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1H621-F1 | 50-373 | 99.68 | 93.03 | View in AlphaFoldDB ↗ |