DPCfam | MC422407
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 215 ± 25 aa |
| Residues in low-complexity regions (%) | 6.55 |
| Residues in coiled-coil regions (%) | 1.65 |
| Predicted disordered residues (%) | 7.95 |
| Average transmembrane regions | 3.71 |
| Dominant Pfam architecture(s) | PF15383 |
| Sequences matching dominant architecture (%) | 94.44 |
| Average overlap percent | 82.58 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I8GZE5 | 1432-1629 | 198 | QQRLEQERKEREQYLEGVVEEDTSNRTLKCAIGFTKVYNYLGTVLLGLMPGFALLHTVYVWTLSSNYLSFLADYSRLGSPMPILY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VW76-F1 | 458-694 | 88.37 | 69.61 | View in AlphaFoldDB ↗ |