DPCfam | MC421716
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 421 |
|---|---|
| Mean domain length (aa) | 125 ± 12 aa |
| Residues in low-complexity regions (%) | 1.88 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 38.73 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10543 |
| Sequences matching dominant architecture (%) | 0.37 |
| Average overlap percent | 5.25 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00068E4831 | 4-139 | 136 | SKLPRGLRNNNPGNIEKSNSSWRGKVPHDQNTDGRFEQFQDFEGIPAMTWGVRALTKLGWTYLKQRPDHTIQTFFEKYAPVVENN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GVH4-F1 | 3-124 | 96.61 | 95.13 | View in AlphaFoldDB ↗ |