DPCfam | MC421692
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 405 ± 44 aa |
| Residues in low-complexity regions (%) | 2.99 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.17 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF02219- PF12225 |
| Sequences matching dominant architecture (%) | 92.0 |
| Average overlap percent | 91.15 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1G0XP96 | 45-474 | 430 | NSSASQFFDFEVAASKVDNMPVSLAFTDKLQSHDSWNVADFAAAVSKDNRKEHIIYLSGRNTTREELENTLSACKTYGFTNVVPV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O06745-F1 | 351-597 | 59.38 | 93.41 | View in AlphaFoldDB ↗ |