DPCfam | MC42146
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 210 ± 29 aa |
| Residues in low-complexity regions (%) | 3.37 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.08 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07724 |
| Sequences matching dominant architecture (%) | 14.63 |
| Average overlap percent | 1.8 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S3B3H9 | 874-1101 | 228 | EERLLKAKCWPLRIEVASSFGDQTNRSKTVSDTERKSIPNPFFMSKRKLNVIDKSSDHHEKSEIVKRSNKTPTSNKFLDLNRPAE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R0L7V5-F1 | 834-1060 | 99.56 | 65.65 | View in AlphaFoldDB ↗ |