DPCfam | MC421409
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 183 ± 29 aa |
| Residues in low-complexity regions (%) | 1.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.84 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11144 |
| Sequences matching dominant architecture (%) | 94.29 |
| Average overlap percent | 62.56 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0M4GH68 | 22-208 | 187 | RELRIDFSLPTDELNEETGLAILVPGFGGNIDSSVYKKMRESFSDEYNLVVMQCNYFGDDFMQSGSSFNIKGDVNELLTLFSPKE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0P8R7-F1 | 5-222 | 99.52 | 96.67 | View in AlphaFoldDB ↗ |