DPCfam | MC42140
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 67 ± 6 aa |
| Residues in low-complexity regions (%) | 0.42 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.49 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V3ZH72 | 60-132 | 73 | MDAFSMAVSYGLQYGVPLRTFVNAFTSTRFEPAGITDDPDLRIATSILDYIFRRLAVEYLDADERAELGIRTG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O69981-F1 | 791-855 | 97.01 | 92.03 | View in AlphaFoldDB ↗ |