DPCfam | MC42102
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 241 |
|---|---|
| Mean domain length (aa) | 53 ± 7 aa |
| Residues in low-complexity regions (%) | 0.98 |
| Residues in coiled-coil regions (%) | 0.6 |
| Predicted disordered residues (%) | 10.33 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF10186 |
| Sequences matching dominant architecture (%) | 70.87 |
| Average overlap percent | 20.45 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| N6U119 | 396-453 | 58 | KEREFPLYTKGRDRAHFSYAVFLLNKNISQLRWFMHRKLTVDLKETLKHLRYLLLGED... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E7EY87-F1 | 405-456 | 98.15 | 91.86 | View in AlphaFoldDB ↗ |