DPCfam | MC421019
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 441 |
|---|---|
| Mean domain length (aa) | 181 ± 20 aa |
| Residues in low-complexity regions (%) | 1.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.41 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05076 |
| Sequences matching dominant architecture (%) | 98.14 |
| Average overlap percent | 85.24 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0X3V6B8 | 6-179 | 174 | EHLESHLGLISGGYRGDGLQVIYSEAGLPFEGVRTLVTAGLGRLDLDLPDGSTVRQELVMHVPAGAAYQDRTAALLLQVAKRMAD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P45941-F1 | 18-191 | 96.49 | 96.75 | View in AlphaFoldDB ↗ |