DPCfam | MC420806
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 91 ± 9 aa |
| Residues in low-complexity regions (%) | 7.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.22 |
| Average transmembrane regions | 1.57 |
| Dominant Pfam architecture(s) | PF12597 |
| Sequences matching dominant architecture (%) | 97.49 |
| Average overlap percent | 88.73 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R0L9Y9 | 3-92 | 90 | FKLLGFLDVKNVPCARESVLYGSVGSLVVGLGHFLATSRVKRSCDFAVGGFICTMLGYWFYCRYILAKHRIRQRMLKEGMRNKIL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1H9F6-F1 | 79-167 | 97.75 | 80.05 | View in AlphaFoldDB ↗ |