DPCfam | MC420601
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 351 |
|---|---|
| Mean domain length (aa) | 802 ± 161 aa |
| Residues in low-complexity regions (%) | 3.63 |
| Residues in coiled-coil regions (%) | 0.01 |
| Predicted disordered residues (%) | 21.85 |
| Average transmembrane regions | 1.14 |
| Dominant Pfam architecture(s) | PF01833- PF01833- PF08337 |
| Sequences matching dominant architecture (%) | 21.51 |
| Average overlap percent | 95.04 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A151MK93 | 771-1724 | 954 | VFSDVVTVNMSKEGKSKERYTYVLPVVHSITPSLGPKAGGTKVTIRGNNLSVGSELRVLVNNTRQCTDISRADTTITCIMPAVER... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O43157-F1 | 1176-2109 | 100.00 | 77.88 | View in AlphaFoldDB ↗ |