DPCfam | MC420070
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 104 ± 17 aa |
| Residues in low-complexity regions (%) | 1.52 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.92 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07914 |
| Sequences matching dominant architecture (%) | 95.56 |
| Average overlap percent | 45.8 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W2SW76 | 17-149 | 133 | IPVAEVWYARRFTESNPLKGYLIMEYLNNIKAVHIFENVPLKSMEQVLRAKAALEALSLRFTSEEKKQFTANFTEVFADFYTEEA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9XUP2-F1 | 142-247 | 99.07 | 92.19 | View in AlphaFoldDB ↗ |