DPCfam | MC420001
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 212 ± 27 aa |
| Residues in low-complexity regions (%) | 2.81 |
| Residues in coiled-coil regions (%) | 1.6 |
| Predicted disordered residues (%) | 22.97 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04082 |
| Sequences matching dominant architecture (%) | 6.0 |
| Average overlap percent | 2.13 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M7TNJ8 | 262-462 | 201 | ISWHQAHCDLYRLMLRGYPEAAPSVVLDAIGAGHIAKAESECLKHATAIIQTLTNLNQQSTSRHLLEFDTAICAYHASRLLLYIS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7Q3H9-F1 | 453-674 | 97.50 | 79.36 | View in AlphaFoldDB ↗ |